People

Harris Wang (Principal Investigator)

Interim Chair of the Department of Systems Biology
Associate Professor in Systems Biology (with tenure)

Office: Room 203BB,  Mary Lasker Biomedical Research Building
Email: hw2429@columbia.edu
Office: 1-212-305-1697
CV | PubMed | Google Scholar | Twitter

Harris Wang is the Interim Chair of the Department of Systems Biology and an Associate Professor in the Department of Pathology and Cell Biology at Columbia University Irving Medical Center. He holds degrees from MIT (double B.S. in Physics & Math) and Harvard (Ph.D. in Biophysics & Medical Engineering Medical Physics). Dr. Wang's numerous accolades include PECASE, Vilcek Prize, Blavatnik National Awards, Schaefer ScholarBWF PATH Investigator, ONR Young InvestigatorSloan Research FellowshipNSF CAREERNIH Early Independence Award, and Forbes 30 Under 30 in Science.


Kristin Beiswenger

Executive Director, Scientific Operations
kmb2237@cumc.columbia.edu

Kristin serves as the Scientific Program Director of DARPA PREPARE and DARPA Arcadia and works on the technology transition and commercialization of various lab inventions. She received her MS in Chemistry from Penn State and her MHA from Columbia University. When she’s not writing technical or financial reports, you can find her cooking for a dinner party, rock climbing, or at a hot yoga class. 

Favorite meal: Roberto soup
Favorite yoga pose: Dead bug


Tiffany Seto, PhD

Staff Scientist
ts2992@cumc.columbia.edu

Tiffany is a Staff Scientist and Lab Manager for the lab. She received her PhD in Biomedical Sciences from New York University. When she’s not managing over a million dollars in lab supplies spending per year, you can find her at home watching Bluey with her two daughters, listening to "Let It Go" on repeat, all while pretending to be a playground structure on which they can climb and jump.

Favorite TV shows: Star Wars: The Clone Wars & Fresh Prince of Bel-Air
Favorite book: Tao Te Ching


Nickle Fisher

Administrative Assistant
nf2575@cumc.columbia.edu

Nickle is the Administrative Assistant for the lab. She was previously an Administrative Assistant for Chanel. When she’s not wrangling Harris' crazy calendar, you can find her spending time with her kids and listening to music.

Favorite book: The Power of Now
Favorite band: Coldplay


Liyuan Liu, PhD

Associate Research Scientist
ll3190@cumc.columbia.edu

Liyuan is an Associate Research Scientist in the lab focusing on the ‘Towards Life with a Reduced Protein Alphabet’ project. He received his PhD in Genetics from the Kunming Institute of Zoology at the Chinese Academy of Sciences and is interested in developing new bioengineering strategies. When he’s not in the lab working on recombineering and variant fitness measurements, you can find him at home working on his kid’s homework!

Favorite holiday: Spring Festival
Favorite vacation: Gold Coast, Australia


Leonie Brockmann, PhD

Associate Research Scientist
lb3166@cumc.columbia.edu

Leonie is an Associate Research Scientist in the lab interested in the interactions of microbiota-associated metabolites with the host and its immune system. She received her PhD in Immunology from the University Hamburg, Germany. When she is not in the mouse room setting up experiments or collecting poop, Leonie can be found running along the Hudson river training for the next race.

Favorite TV show: Star Trek – The Next Generation
Favorite holiday: Christmas (in Germany, obviously)


Yuanyuan Huang, PhD

Associate Research Scientist
yh3727@cumc.columbia.edu

Yuanyuan is an Associate Research Scientist in the lab focusing on engineering functional living fungal-bacterial materials. She received her PhD in fermentation engineering from South China University of Technology. When she’s not engineering living cells, you can find her playing badminton or practicing yoga.

Favorite drink: Coffee
Favorite sport: Badminton


Diego Gelsinger, PhD

Postdoctoral Research Scientist (co-advised with Prof. Sam Sternberg)
drg2165@cumc.columbia.edu

Diego is a Postdoc in the lab jointly with the Sternberg lab working on CRISPR and engineering microbial communities. He received his PhD in Molecular Biology and Microbiology from Johns Hopkins University. When he’s not running between both labs down 168th street, you can find him biking through the boroughs of NYC.

Favorite music genre: 1990s rap
Favorite street food: Tacos


Chao Chen, PhD

Postdoctoral Research Scientist
cc4865@cumc.columbia.edu

Chao is a Postdoc in the lab working on biological tools to study cell physiology and engineer cells with new functions. He received his PhD from Peking University in Chemical Biology. When he’s not playing with cells in the lab, you can find him trying to learn cooking in his kitchen. 

Favorite computer game: FIFA
Favorite singer: Jay Chou


Jeongchan Lee, PhD

Postdoctoral Research Scientist
jl6482@cumc.columbia.edu

Jeongchan is a Postdoc in the lab working on soil microbiome and engineering gut microbes. He received his PhD in Chemical & Biological Engineering from Seoul National University. When he’s not culturing bacteria in the lab, you can find him running around the park in Fort Lee.

Favorite sports: Jogging and soccer
Favorite drink: Coffee


Liyuan Lin, PhD

Postdoctoral Research Scientist
ll3778@cumc.columbia.edu

Liyuan is a Postdoc in the lab working on spatial metagenomics of the gut microbiome. She received her PhD in Microbiology and Chemical Biology from Shanghai Jiao Tong University. When she’s not experimenting with bacteria and mice, you can find her exploring the online world.

Favorite restaurant: Szechuan Garden
Favorite star: Zi Yang


Taehee Han, PhD

Postdoctoral Research Scientist
th3138@cumc.columbia.edu

Taehee is a Postdoc in the lab working on enhancing immune cell function and developing biological tools to study cell metabolism. She received her PhD in Chemical and Biomolecular engineering from KAIST. When she’s not playing with cells in the lab, you can find her having a picnic in Central Park.

Favorite actor: Chris Hemsworth
Favorite food: Ma La Xiang Guo


Baiyang Liu, PhD

Postdoctoral Research Scientist
bl3120@cumc.columbia.edu

Baiyang is a Postdoc in the lab working on engineering cyanobacteria as space food. He received his PhD in Systems, Synthetic and Physical Biology from Rice University. When he’s not in the lab engineering bacteria or writing codes, you can find him playing badminton, guitar, and video games.

Favorite composer: Claude Debussy
Favorite Sci-Fi movie: 2001: A Space Odyssey


Deirdre Ricaurte, PhD

Postdoctoral Research Scientist
dr2955@cumc.columbia.edu

Deirdre is an MD-PhD candidate at Columbia University Irving Medical Center. She received her BA in Molecular Biology from Princeton University and her PhD from Columbia University in our lab. When she’s not experimenting with drugs and poop, you can find her at home watching TV with her cat, Luna. 

Favorite podcast: Who? Weekly 
Favorite TV show: Mare of Easttown


Tyler Perdue

Graduate Student
tdp2124@columbia.edu

Tyler is a PhD Student in the Biological Sciences Program. He received his BS in Biological Sciences from University of California Santa Barbara. When he’s not culturing cells, you can find him looking for new places to go around NYC. 

Favorite restaurant: Bar 314
Favorite board game: 7 Wonders


Yiwei Sun

Graduate Student
ys3235@cumc.columbia.edu

Yiwei is a PhD Student in the Bioinformatics Program. She received her BS in Microbiology, Immunology, and Molecular Genetics from UCLA. When she’s not analyzing her sequencing data, you can find her adventuring with her cats.

Favorite boba place: KOI
Favorite city to visit: Amsterdam


Logan Schwanz

Graduate Student
lts2143@columbia.edu

Logan is a PhD Student in the Pathobiology Program. He received BA degrees in Biochemistry and Molecular, Cellular and Developmental Biology (MCDB) from the University of Colorado at Boulder. When he’s not testing his new genetic engineering constructs, you can find him enjoying a slice of his favorite NYC pizza or playing the sax.

Favorite slice in the Heights: Koronet on 172
Favorite jazz standard: Take the A Train


Charlotte Rochereau

Graduate Student (jointly advised w/ Mohammed AlQuraishi)
cr3007@columbia.edu

Charlotte is a PhD Student in the Integrated Program in Cellular, Molecular, and Biomedical Studies Program. She received her MS in Bioengineering and Systems Biology from AgroParisTech and her MA in Management from HEC Paris. When she’s not training models, you can find on her quest for the best French food suppliers in NYC.

Favorite protein: DYKDDDDVDMGQPGNGSAFLLAPNGSHAPDH…
Favorite jazz club: Smalls


Harry Lee

Graduate Student (jointly advised w/ Mohammed AlQuraishi)
hhl2114@cumc.columbia.edu

Harry is a PhD Student in the Integrated Program in Cellular, Molecular, and Biomedical Studies Program. He received his BS and MS in Computer Science from Columbia University. When he’s not wrangling dataframes on his Jupyter notebook, you’ll likely find him catching a live music set around the city.

Favorite ramen spot in NYC: Menkoi Sato
Favorite podcast: Lex Fridman Podcast


Yiming Qu

Graduate Student
yq2355@cumc.columbia.edu

Yiming is a PhD Student in the Integrated Program in Cellular, Molecular, and Biomedical Studies Program. He received his BS in Biological Science from Tsinghua University. When he is not coding or fiddling clumsily with lab equipment, you might find him browsing Twitter aimlessly or playing badminton aggressively.

Favorite music genre: Chinoiserie
Favorite movie: The Hobbit


Teagan Stedman

Graduate Student
ts3556@cumc.columbia.edu

Teagan is a PhD Student in the Nutritional & Metabolic Biology Program. He received his BS in Bioengineering from Harvard College. When he's not in the tissue culture hood, you can find him chemotaxising to the Central Park dirt loop to run.

Favorite reality show: His cats
Favorite band: Periphery


Joseph “Joey” Baer

Research Technician
jbb2169@cumc.columbia.edu

Joey is a Research Technician. He received his B.A. in Neuroscience from Columbia University. When he is not busy working for money at Columbia, he is working for free at Columbia on the board of his undergraduate school’s alumni association.

Favorite band: Steely Dan
Favorite baseball team: San Diego Padres


Daniel Shneider

Undergraduate Student
dws2137@columbia.edu

Daniel is an undergraduate Biology and Art History major at Columbia College. When he’s not wrangling mice, you can find him gallery hopping downtown or binging a Scandinavian mystery show.

Favorite takeout order: General Tso’s Chicken and an eggroll
Favorite museum: MoMA


Stone Su

Undergraduate Student
ss6422@columbia.edu

Stone is an undergraduate Biomedical Engineering major at Columbia University. When he's not furiously debugging his code, you can find him pretending to be Gordon Ramsay in the kitchen or obsessively playing video games on his laptop.

Favorite book series: The Stormlight Archive
Favorite recipe: Coca-Cola Chicken


Om Kar

Undergraduate Student
op2268@columbia.edu

Om is an undergraduate Biochemistry and Psychology major at Columbia College. When he’s not MAGICally CASTing genetic payloads into gut microbes, you can find him baking lopsided cakes, reading the same plot in “different” action novels, or being driven insane by GWB traffic.

Favorite music genre: 2010’s radio pop
Favorite cake flavor: Pineapple upside-down


Theodore Wang

Junior Volunteer

Theo is an understudy in the lab. His aspirations include mastering debate, mathematics, cello, and airbending.  


Elizabeth Wang

Junior Volunteer

Elizabeth is an understudy in the lab. Her aspirations include making the list of Forbes 5 under 5.


GeeMo and friends

Lab mascots

Geemo and his friends are our resident axolotls. They regularly enjoy biting and swallow their tankmates and showing off their regenerative superpowers.


Lab Alumni

Marley Giddins (PhD graduate, Alex Chavez lab), Fall 2022-Fall 2024
Guillaume Urtecho (postdoc), Spring 2020-Fall 2024
Yiming Huang (PhD grad) Fall 2017-Fall 2022 (postdoc)-Summer 2024
Zixuan (Shawn) Meng (undergraduate student), Summer 2024
Ezekiel (Zeke) Johnson (undergraduate student), Summer 2024
Amanda Simkhovich (rotation student), Spring 2024
Martin Liu (rotation student), Spring 2024
Zetian (David) Zhang (undergraduate student), Winter 2023-Spring 2024
Chrystal Mavros (PhD graduate), Fall 2019-Summer 2024
Jasmine Wang (technician), Fall 2022-Summer 2024
Grace Bukowski-Thall (technician), Fall 2022-Summer 2024
Kexuan (Coco) Huang (undergraduate student), Fall 2022-Winter 2023
Miles Richardson (PhD graduate), Fall 2017-Fall 2023
Carlotta Ronda (postdoc), Spring 2016-Fall 2023
Joel Howard (visiting student), Fall 2023-Winter 2023
Chase Armer (technician), Summer 2023
Jiahui (Hazel) Zhao (technician), Spring 2022-Summer 2023
Frederik Neergaard (visiting student), Spring 2023-Summer 2023
Ope Lekan (undergraduate student), Summer 2019-Spring 2023
Shaheed Thabit (undergraduate student), Fall 2022-Spring 2023
Florencia Velez-Cortes (PhD graduate), Spring 2016-Fall 2022
Andrey Zaznaev (rotation student), Spring 2023
Shijie (Jay) Zhao (postdoc), Fall 2021-Fall 2022
Thomas Moody (MD/PhD student), Fall 2020-Fall 2022
Sungsun Yim (postdoc), Fall 2016-Summer 2022
Junming Qian (rotation student), Spring 2022
Sam Levy (rotation student), Fall 2021
Julia Urban (rotation student), Fall 2021
Eric Zhang (rotation student), Summer 2021
Ross McBee (PhD graduate), Summer 2016-Spring 2021
Andrew Kaufman (Senior Staff Scientist), Spring 2017-Fall 2021
Jaysen Zhang (undergraduate student), Summer 2019-Spring 2020
Jonathan Algoo (Staff technician), Fall 2020-Spring 2021
Tomasz Blazejewski (PhD graduate), Fall 2014-Fall 2020
Andrew Liu (rotation student), Summer 2020
Jimin Park (PhD graduate), Fall 2014-Spring 2020
Ravi Sheth (PhD graduate), Fall 2015-Fall 2019
Jennifer Fang (undergraduate student), Summer 2017-Spring 2020
Tarun Srinivasan (undergraduate student), Summer 2017-Spring 2020
Ruxiao Tian (rotation student), Fall 2019
Lucas Cohen (technician), Spring 2019 - Spring 2020
Christian Munck (postdoc), Spring 2017- Spring 2020
Hsing-I Ho (postdoc), Fall 2015 - Winter 2019
Charles Fox (rotation student), Summer 2019
Kendall Dabaghi (graduate student), Fall 2017-Spring 2019
Frank Cusimano (MD/PhD graduate), Fall 2014-Spring 2019
Sway Chen (MD/PhD graduate), Summer 2014-Fall 2018
Nathan Johns (PhD graduate), Spring 2013-Spring 2019
Izaak Coleman (rotation student), Fall 2018
Alan Song (high school volunteer), Summer 2017-Spring 2018
Sydney Blattman (rotation student), Fall 2017
Jacky Cheung (undergraduate student), Summer 2014-Summer 2017
Antonio Gomes (postdoc), Spring 2013-Fall 2016
Suppawat Kongthong (undergraduate student), Summer 2015-Spring 2017
Felix Wu (rotation student), Spring 2017
Christopher Packey (clinical fellow), Fall 2016
Sam Magaziner (undergraduate student), Summer 2015-Spring 2016
James DiCarlo (medical student), Summer 2015-Spring 2016
Vitor Cabral (postdoc), Fall 2014 - Spring 2016
Hanna Levitin (rotation student), Fall 2015
Emily Groopman (rotation student), Summer 2015
Victoria Stockman (graduate student), Fall 2013-Spring 2015
Julian Berger (rotation student), Spring 2015
Zach Baker (rotation student), Fall 2014
Allen Zhu (technician), Fall 2013-Spring 2014
Tal Lorberbaum (rotation student), Fall 2013
John Szymanski (rotation student), Fall 2013
Anthony Yang (undergraduate student), Summer/Winter 2013
Daniel Huang (undergraduate student), Summer 2013